Analytical Data
-
Gene name
NES1
- Application
-
Alternative Names
NES1；NES1；PRSSL1；Kallikrein-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43240
-
Expression Region
31-274aa
-
AA Sequence
AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
-
Molecular Weight
30.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NES1 protein, a member of the nucleoporins family, plays a pivotal role in nuclear-cytoplasmic transport, which is essential for various cellular processes, including gene expression and cell signaling. Given the importance of nuclear transport in maintaining cellular homeostasis and its implications in various diseases, including cancer and neurodegenerative disorders, researchers are increasingly focused on studying the structure and function of NES1. Initial studies identified NES1's involvement in facilitating the export of proteins and RNA from the nucleus, enhancing our understanding of its role in cellular regulation. Furthermore, the recombinant expression of NES1 has enabled scientists to investigate its interactions with other nuclear proteins and its mechanistic pathways in greater detail. Characterizing the properties of NES1 through recombinant protein analysis has not only provided insights into its functional dynamics but also highlighted potential therapeutic targets for drug development. Investigating NES1 has significant implications for understanding nuclear transport mechanisms and their relevance in pathological conditions, paving the way for innovative strategies to modulate its activity for therapeutic benefit.
