Analytical Data
-
Gene name
RAB27B
- Application
-
Alternative Names
RAB27B;Ras-related Protein Rab-27B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00194
-
Expression Region
1-218aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTDGDYDYLIKLLALGDSGVGKTTFLYRYT DNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQER FRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVL IGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB27B is a member of the RAB family of small GTPases, which are pivotal in regulating intracellular transport processes, particularly in the exocytosis of secretory granules. This protein plays a crucial role in various cellular functions, including the secretion of hormones, neurotransmitters, and various biomolecules. Studies have shown that RAB27B is essential for the proper function of immune cells, such as mast cells and cytotoxic T lymphocytes, where it governs the release of inflammatory mediators and cytotoxic granules. Mutations or dysregulation of RAB27B have been linked to various diseases, including immunological disorders and cancer, highlighting its potential as a therapeutic target. The recombinant expression and functional characterization of RAB27B allow researchers to better understand its role in cellular mechanisms and its implications in disease pathology. The availability of RAB27B protein in a recombinant form facilitates structural studies and the identification of interacting partners, paving the way for the development of targeted therapies aimed at modulating its activity in diseases where its function is compromised. Overall, the exploration of RAB27B as a research subject holds promise for uncovering novel insights into intracellular trafficking and enhancing our understanding of related pathophysiological processes.
