Analytical Data
-
Gene name
OR6K6
- Application
-
Alternative Names
OR6K6; Olfactory receptor 6K6; Olfactory receptor OR1-21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGW6
-
Expression Region
1-343 aa
-
AA Sequence
MKQYSVGNQHSNYRSLLFPFLCSQMTQLTASGNQTMVTEFLFSMFPHAHRGGLLFFIPLL LIYGFILTGNLIMFIVIQVGMALHTPLYFFISVLSFLEICYTTTTIPKMLSCLISEQKSI SVAGCLLQMYFFHSLGITESCVLTAMAIDRYIAICNPLRYPTIMIPKLCIQLTVGSCFCG FLLVLPEIAWISTLPFCGSNQIHQIFCDFTPVLSLACTDTFLVVIVDAIHAAEIVASFLV IALSYIRIIIVILGMHSAEGHHKAFSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTA IAVTFVILAPFFNPIIYSLKNKDMKEAIGRLFHYQKRAGWAGK
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR6K6 protein, part of the olfactory receptor family, has attracted research interest due to its unique role in the sense of smell and potential implications in sensory biology and neurobiology. Olfactory receptors are G protein-coupled receptors (GPCRs) that play a crucial role in recognizing volatile chemical compounds, contributing to the perception of odors. The OR6K6 receptor is thought to be involved in the detection of specific ligands, and its activation can trigger a signaling cascade that ultimately influences olfactory processing in the brain. Given the complexity of the olfactory system and the myriad of receptors it comprises, studying OR6K6 and its ligand interactions can provide insights into the mechanisms behind olfactory signal transduction. Furthermore, understanding the structural and functional properties of this receptor could have broader implications for developing therapeutic strategies for olfactory dysfunction and gaining insights into how our sensory systems evolve and adapt. As research into OR6K6 progresses, it may offer new avenues for exploring how olfaction influences behavior, memory, and emotional responses, thereby enhancing our understanding of the intricate connections between the sensory systems and cognitive functions.
