Analytical Data
-
Gene name
OR6K2
- Application
-
Alternative Names
OR6K2; Olfactory receptor 6K2; Olfactory receptor OR1-17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGY2
-
Expression Region
1-324 aa
-
AA Sequence
MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE AIKKHIGQAKIFFSVRPGTSSKIF
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR6K2 protein, a member of the olfactory receptor family, has garnered significant interest in the field of molecular biology and neurobiology due to its unique role in sensory perception. Olfactory receptors constitute a large and diverse gene family that is predominantly expressed in the olfactory epithelium, where they play a critical role in the detection of odorant molecules. OR6K2, specifically, is known to be activated by specific odorants, making it a valuable subject for studying the mechanisms of olfactory signal transduction and its implications in behavior and environmental interactions. Research surrounding OR6K2 has also expanded into the realms of physiology and pathology, as alterations in olfactory receptor expression have been linked to various neurological disorders and diseases. The recombinant expression of OR6K2 allows for the detailed characterization of its structure and function, facilitating insights into how this receptor contributes to the overall landscape of olfactory receptor functionality. Additionally, exploring the ligand specificity and signaling pathways associated with OR6K2 may lead to therapeutic advancements in treating conditions related to olfactory dysfunction. Recent advancements in recombinant protein technology have enabled researchers to produce and purify OR6K2 efficiently, providing a platform for further investigations into its biological significance and potential applications in medicine and biotechnology. Overall, the study of OR6K2 not only enhances our understanding of the olfactory system but also opens avenues for addressing clinical challenges associated with sensory disorders.
