Analytical Data
-
Gene name
ANAPC15
- Application
-
Alternative Names
ANAPC15；C11orf51；Anaphase-promoting complex subunit 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60006
-
Expression Region
1-121aa
-
AA Sequence
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANAPC15, also known as APC15 or Cdc20, is an essential component of the Anaphase Promoting Complex/Cyclosome (APC/C), a crucial E3 ubiquitin ligase in the cell cycle regulation. The primary function of APCC is to target specific proteins for destruction via ubiquitination, thereby facilitating the transition from metaphase to anaphase during cell division. Understanding the structure and function of ANAPC15 is vital, as its dysfunction is often linked to various cancers and other diseases characterized by abnormal cell proliferation. Studies have indicated that ANAPC15 interacts with multiple co-factors, including Cdc20 and other regulatory proteins, to ensure precise timing of substrate recognition and ubiquitination. Research into the molecular structure of ANAPC15 has unveiled insights into its role in controlling protein degradation pathways, maintaining genomic stability, and preventing tumorigenesis. Moreover, the investigation of ANAPC15 in different cellular contexts has led to a better understanding of its regulation under stress conditions and its contributions to various signaling pathways. The development of recombinant ANAPC15 proteins for experimental use has become crucial for elucidating its biochemical properties and interactions within the APC/C complex, contributing significantly to cell cycle research and therapeutic developments targeting aberrant cell division in cancer. Overall, ANAPC15 represents a pivotal area of study in molecular and cellular biology, with implications for both fundamental science and clinical applications.
