Analytical Data
-
Gene name
UCMA
- Application
-
Alternative Names
UCMA；C10orf49；Unique cartilage matrix-associated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVF2
-
Expression Region
65-138aa
-
AA Sequence
GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEER SREAVEQWRQWHYDG LHPSYLYNRHHT
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCMA (UroCanic Acid Modifying Protein) is a member of the small leucine-rich proteoglycan family, which plays a significant role in extracellular matrix organization and cellular functions. Research on UCMA has gained momentum due to its involvement in various biological processes, including tissue repair, inflammation, and tumor progression. Its unique structure, characterized by a high content of leucine-rich repeats, enables UCMA to interact with other extracellular matrix components and signaling molecules, influencing cell behavior and microenvironment. Additionally, UCMA has been found to have potential as a biomarker for certain diseases, including cancer, thereby sparking interest in its therapeutic implications. The ability to produce recombinant UCMA protein has facilitated in-depth studies of its functional properties and mechanisms at the molecular level. Understanding UCMA's role in pathophysiological conditions could pave the way for novel therapeutic strategies targeting matrix-related disorders and enhancing tissue engineering approaches. As a result, UCMA has emerged as a promising candidate for further exploration in both fundamental research and clinical applications, making it a critical focus in the fields of cell biology and regenerative medicine.
