Cat: PA1000-4882

Recombinant Human UCMA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UCMA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UCMA;C10orf49;Unique cartilage matrix-associated Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WVF2

  • Expression Region

    65-138aa

  • AA Sequence

    GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEER SREAVEQWRQWHYDG LHPSYLYNRHHT

  • Molecular Weight

    10 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UCMA (UroCanic Acid Modifying Protein) is a member of the small leucine-rich proteoglycan family, which plays a significant role in extracellular matrix organization and cellular functions. Research on UCMA has gained momentum due to its involvement in various biological processes, including tissue repair, inflammation, and tumor progression. Its unique structure, characterized by a high content of leucine-rich repeats, enables UCMA to interact with other extracellular matrix components and signaling molecules, influencing cell behavior and microenvironment. Additionally, UCMA has been found to have potential as a biomarker for certain diseases, including cancer, thereby sparking interest in its therapeutic implications. The ability to produce recombinant UCMA protein has facilitated in-depth studies of its functional properties and mechanisms at the molecular level. Understanding UCMA's role in pathophysiological conditions could pave the way for novel therapeutic strategies targeting matrix-related disorders and enhancing tissue engineering approaches. As a result, UCMA has emerged as a promising candidate for further exploration in both fundamental research and clinical applications, making it a critical focus in the fields of cell biology and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US