Cat: PA1000-4883

Recombinant Human AKR1C2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKR1C2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKR1C2;DDH2;Aldo-keto reductase family 1 member C2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52895

  • Expression Region

    1-323aa

  • AA Sequence

    MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHID SAHVYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDY VDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNH RLLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDP NSPVLLEDPV LCALAKKHKRTPALIA

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKR1C2, a member of the aldo-keto reductase (AKR) superfamily, plays a significant role in the metabolism of steroid hormones, prostaglandins, and various xenobiotics. Research into AKR1C2 has garnered attention due to its implications in several physiological and pathological processes, including hormone regulation, cancer progression, and metabolic disorders. The enzyme is involved in the reduction of androstenedione to testosterone, highlighting its importance in androgen metabolism, which can impact prostate cancer and other hormone-related diseases. Furthermore, AKR1C2 has been implicated in the detoxification processes of reactive carbonyl species, underscoring its potential role in cellular protection against oxidative stress. The recombinant expression of AKR1C2 has enabled more detailed studies on its enzymatic properties, substrate specificity, and potential as a therapeutic target. Investigating the structure-function relationship of AKR1C2 through techniques such as crystallography and mutagenesis has provided insights into its molecular mechanisms and interaction with various ligands. Given the increasing awareness of the enzyme's role in drug metabolism and disease, further research into AKR1C2 may pave the way for novel therapeutic strategies and biomarkers for disease prognosis. This highlights the necessity of continued exploration into its functional characteristics and regulatory mechanisms, which could ultimately facilitate advancements in personalized medicine and treatment modalities for conditions influenced by steroid hormone metabolism.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US