Cat: PA1000-5307

Recombinant Human EBI3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EBI3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EBI3;ORCA;OSIL;Sequestosome-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14213

  • Expression Region

    21-229aa

  • AA Sequence

    RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV SFIATYRL GMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSF VP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYW IRYKRQGAARFHRV GPIEATSFILRAVRPRARYYVQVAAQDLTDYGEL SDWSLPATATMSLGK

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EBI3 (Epstein-Barr virus-induced gene 3) is a crucial component of the IL-27 cytokine family, playing a significant role in the immune response and inflammation regulation. It forms a heterodimer with IL-12p35 to produce the bioactive cytokine IL-27, which is known for its ability to modulate T cell differentiation, particularly in promoting the development of Th1 and inhibiting Th2 responses. Given its critical function in immune modulation, EBI3 has garnered attention in various research areas, including cancer immunotherapy, autoimmune diseases, and infectious diseases. Studies have shown that EBI3 can influence the tumor microenvironment, affecting the remodeling of immune cell populations and the overall anti-tumor response. Consequently, the recombinant production of EBI3 has become an area of intense investigation aimed at understanding its biological functions and therapeutic potential. Researchers are exploring the use of EBI3-based reagents for therapeutic applications, including enhancing anti-tumor immunity and developing novel treatments for chronic inflammatory conditions. The recombinant protein’s structural and functional characterization, along with its interactions with other cytokines and immune cells, remains a focal point of current studies, aiming to unlock its potential in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US