Analytical Data
-
Gene name
TESC
- Application
-
Alternative Names
TESC；CHP3；Calcineurin B homologous Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BS2
-
Expression Region
2-214aa
-
AA Sequence
GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TESC, or Testis-specific protein Y-encoded, is a gene that plays a crucial role in spermatogenesis and has garnered interest in the field of reproductive biology and gene therapy. Research into TESC recombinant proteins is particularly significant due to their potential applications in male fertility treatments and cancer therapies. The protein is predominantly expressed in the testes, suggesting its involvement in male germ cell development. Recent studies have indicated that alterations in TESC expression may be linked to various reproductive disorders, making it a target for understanding male infertility. Additionally, TESC and its derivatives may have implications in oncological research, as certain patterns of gene expression can be associated with cancer cell proliferation. The development of recombinant TESC proteins allows for detailed functional studies and assessment of their biological properties, paving the way for innovative therapeutic strategies. Moreover, the ability to produce TESC proteins in significant quantities can aid in the creation of diagnostic tools or vaccines that could enhance our understanding of testicular function and male reproductive health. Overall, the study of TESC recombinant proteins is poised to contribute to both fundamental biology and applied medical research, highlighting their importance in both reproductive health and cancer biology.
