Analytical Data
-
Gene name
RAD54B
- Application
-
Alternative Names
RAD54B; DNA repair and recombination protein RAD54B; EC 3.6.4.-; RAD54 homolog B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y620
-
Expression Region
1-158 aa
-
AA Sequence
MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAD54B is a member of the RAD54 family of proteins, which are crucial for the homologous recombination (HR) repair pathway of DNA double-strand breaks. This pathway is essential for maintaining genomic stability and integrity in eukaryotic cells. RAD54B, in particular, is known to facilitate the search for homologous sequences during DNA repair, promote strand invasion, and help in the remodeling of DNA structures. Dysregulation or mutation of RAD54B has been associated with various cancers, highlighting its importance in tumorigenesis and the development of therapeutic resistance. Furthermore, RAD54B interacts with several proteins involved in DNA repair and cell cycle regulation, indicating its role as a key player in these complex cellular processes. Recent studies have aimed to elucidate the precise mechanisms by which RAD54B contributes to HR and to investigate its potential as a target for cancer therapy. Understanding the functional dynamics of RAD54B not only provides insights into the molecular basis of DNA repair but also opens avenues for novel treatment strategies in cancer, potentially improving outcomes for patients with RAD54B-related malignancies.
