Analytical Data
-
Gene name
C1orf84
- Application
-
Alternative Names
KICSTOR complex Protein SZT2. Seizure threshold 2 Protein homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T011
-
Expression Region
1-178aa
-
AA Sequence
MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLSHLHQTVQATPQEMLSEQELEVLSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDEVFHALSRCLGGLLRPFRVPGSCIDFQPEIYVTIQAYSSIIGLQSHQRQGFTMLARLPSNF
-
Molecular Weight
46.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf84, also known as Chromosome 1 Open Reading Frame 84, is a protein of interest due to its potential involvement in various cellular processes and its relevance in multiple diseases. Despite its identification, the exact biological functions and mechanisms of action of C1orf84 remain largely unexplored. Recent studies have suggested that C1orf84 may play a role in cellular stress responses and may be implicated in disorders such as cancer, where abnormal regulation of gene expression occurs. The recombinant expression of C1orf84 has gained attention as a means to elucidate its structure and function, enabling researchers to investigate its interactions with other proteins and cellular pathways. By studying the recombinant C1orf84 protein, scientists aim to uncover insights into its biological role, potential post-translational modifications, and the implications of its dysregulation in pathological conditions. This research is crucial for understanding the contributions of C1orf84 to health and disease, potentially leading to novel therapeutic targets or biomarkers for diagnosis. Overall, the investigation of C1orf84 recombinant protein is a significant step toward unraveling its mystery and establishing its relevance in cellular biology and medicine.
