Analytical Data
-
Gene name
C1orf74
- Application
-
Alternative Names
C1orf74; UPF0739 Protein C1orf74
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LT6
-
Expression Region
1-269aa
-
AA Sequence
MLLLDLMSSPSPQLLVAAAQQTLGMGKRRSPPQAICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLHILEIGENSLIVSPEHVCQHLEQVLLGTIAFVDVSSCQRHPSVCSLDQLQDLKALVAEIITHLQGLQRDLSLAVSYSRLHSSDWNLCTVFGILLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADLSISSEIVTLPAVAL
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf74, also known as Chromosome 1 Open Reading Frame 74, is a protein of interest due to its potential role in various biological processes and its implications in human health. Initially identified through genomic studies, this protein is located on chromosome 1 and is thought to be involved in cellular functions such as protein synthesis and cellular signaling pathways. Research has highlighted its expression patterns in different tissues, suggesting a role in specific cellular functions and possibly in disease mechanisms. Recent studies have indicated that altered expression of C1orf74 may be associated with certain cancers and neurodegenerative disorders, prompting further investigation into its molecular functions and interactions. The generation of C1orf74 recombinant proteins has been key in studying its biochemical properties, folding, and interaction with other proteins, which may provide insights into its functional roles and pathways. Understanding the structure-function relationship of C1orf74 could elucidate its contributions to various pathophysiological conditions, making it a promising target for future therapeutic interventions. Overall, the continued exploration of C1orf74 as a recombinant protein holds significant potential for advancing knowledge in cell biology and developing new strategies in disease management.
