Analytical Data
-
Gene name
C1orf64
- Application
-
Alternative Names
SRARP; C1orf64; ERRF; SSPR; Steroid receptor-associated and regulated Protein; ER-related factor; Steroid receptor-regulated Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NEQ6
-
Expression Region
1-169aa
-
AA Sequence
MAPSEDPRDWRANLKGTIRETGLETSSGGKLAGHQKTVPTAHLTFVIDCTHGKQLSLAATASPPQAPSPNRGLVTPPMKTYIVFCGENWPHLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQAD
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf64, also known as Chromosome 1 Open Reading Frame 64, has emerged as an intriguing subject of study in molecular biology due to its potential role in various cellular processes and diseases. This gene, located on chromosome 1, encodes a protein whose precise function remains largely undefined, but preliminary research suggests it may be involved in cellular signaling pathways and protein interactions that could influence cell proliferation and apoptosis. Initial studies have indicated that C1orf64 may have implications in cancer, neurodegenerative diseases, and other pathological conditions, raising the question of whether it could serve as a potential biomarker or therapeutic target. Recombination and expression of C1orf64 in model organisms and cell lines can elucidate its biological role and help in understanding the molecular mechanisms underlying its involvement in disease. Furthermore, generating a recombinant protein forms the basis for various biochemical assays that can assess protein function, interaction partners, and regulatory mechanisms. Investigating C1orf64's structure and function through recombinant technology may facilitate the development of novel diagnostic and therapeutic approaches, highlighting its significance in both basic research and clinical applications. As such, ongoing research into C1orf64 not only aims to uncover its biological importance but also to explore its potential as a target for innovative treatments in various diseases, emphasizing the need for continued investigation in this nascent field of study.











