Analytical Data
-
Gene name
all1616
- Application
-
Alternative Names
all1616；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8YWJ
-
Expression Region
1-227aa
-
AA Sequence
MRWVDDSYLLPAAKGLMSTSVPNTYAKLAKALLINYSFDLSGYHVDELVNRWQKQYPADWLHLAVIEALYQGRYKAISVQQLLAFWQRRGQEIYHFNMEFERLICSKFPESLTPMAASEQYSRQGKNQNQTLQLMSFKQQEQVKEEEEPPTEKMLALSSTSVTASIEVSVSQQEDYLGQPFSLNPDISTKLLPISVTHPPIGQFTPQTSDRSESFTSKLKAISNENS
-
Molecular Weight
25.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
All1616 is a recombinant protein derived from the Allochroococcum genus, which has garnered attention due to its potential applications in biotechnology and medicine. This protein is believed to possess unique structural and functional properties, which can be leveraged in enzyme engineering, protein design, and therapeutic development. Research surrounding All1616 has centered on its functional characterization, stability under different environmental conditions, and its interactions with other biomolecules. Studies have shown that the protein exhibits promising catalytic activities, making it a candidate for industrial applications such as biocatalysis in chemical synthesis. Additionally, its stability at extreme temperatures and pH levels could enhance its utility in various bioprocesses. Investigations into the genetic and biochemical pathways that govern the expression of All1616 also provide insights into its evolutionary significance and adaptability within its natural habitat. As researchers continue to delve into the properties and potential applications of All1616, this protein stands out as a promising subject for further exploration in the fields of enzymology, synthetic biology, and therapeutic innovation.
