Analytical Data
-
Gene name
C1orf88
- Application
-
Alternative Names
PIFO; C1orf88; Protein pitchfork
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCI5
-
Expression Region
1-191aa
-
AA Sequence
MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYDLSKIPTSIKGYTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFKNYPKDTYYPSPGAYNPEKKPPPKIAWPMKFGSPDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN
-
Molecular Weight
48.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf88, also known as Chromosome 1 Open Reading Frame 88, is a protein-coding gene implicated in various biological processes, including cellular differentiation, proliferation, and potential roles in immune responses. The interest in C1orf88 has grown due to its association with several pathological conditions, including autoimmune diseases and certain cancers, which suggests its involvement in crucial signaling pathways and cellular mechanisms. Recombinant C1orf88 protein has been studied to elucidate its structure-function relationships, allowing researchers to investigate its biochemical properties and interactions with other cellular components. The production of recombinant C1orf88 provides a valuable tool for understanding the protein’s role in health and disease, as well as its potential as a biomarker or therapeutic target. By examining its functional characteristics and how it modulates cellular activities, researchers aim to uncover the underlying mechanisms through which C1orf88 may influence disease progression. Additionally, recombinant proteins like C1orf88 serve as key components in immunological assays and structural studies, further contributing to the development of targeted therapeutic strategies. Overall, the study of recombinant C1orf88 protein is essential for advancing our understanding of its biological significance and potential applications in medical research.
