Analytical Data
-
Gene name
C1orf89
- Application
-
Alternative Names
CPLANE2; C1orf89; RSG1Ciliogenesis and planar polarity effector 2; REM2- and Rab-like small GTPase 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BU20
-
Expression Region
1-258aa
-
AA Sequence
MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHGTTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE
-
Molecular Weight
54.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf89, also known as chromosome 1 open reading frame 89, is a gene located on chromosome 1 that has garnered attention in recent years due to its potential implications in human health and disease. Initial studies suggest that C1orf89 may play a significant role in various cellular processes, although its exact function remains largely enigmatic. Research has indicated links between C1orf89 and several diseases, including neurodevelopmental disorders, where mutations or aberrations in this gene could contribute to pathology. Furthermore, the protein product of C1orf89 has been implicated in the regulation of cellular signaling pathways and gene expression, making it a prime candidate for investigating its role in tumorigenesis and metastasis in cancer biology. The recombinant C1orf89 protein offers a unique opportunity to delve deeper into these biological functions and interactions. By expressing and purifying this protein, researchers aim to conduct functional assays, develop antibodies, and explore its potential as a biomarker for disease diagnosis or prognosis. Overall, the study of C1orf89 and its recombinant protein is positioned at the intersection of molecular biology and clinical research, potentially leading to novel therapeutic strategies and enhancing our understanding of the underlying mechanisms of diseases where this gene plays a critical role. As investigations continue, elucidating the significance of C1orf89 could pave the way for innovative approaches in precision medicine and targeted therapies.
