Analytical Data
-
Gene name
pscF
- Application
-
Alternative Names
pscF；pscF；Type 3 secretion system needle filament Protein
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P95434
-
Expression Region
2-85aa
-
AA Sequence
AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
-
Molecular Weight
16.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the pscF recombinant protein is rooted in the understanding of its role in the pathogenesis of certain bacterial infections, particularly those caused by Pseudomonas aeruginosa. PscF is a key component of the polysaccharide synthesis machinery, specifically involved in the production of the exopolysaccharide called Psl, which is crucial for biofilm formation and bacterial virulence. Biofilms are communities of microorganisms that adhere to surfaces, providing enhanced protection against environmental stresses and antibiotic treatments. Research has indicated that targeting pscF could offer new therapeutic strategies for managing infections associated with biofilm-forming bacteria, which often resist conventional treatments. The recombinant expression of pscF allows for detailed structural and functional analyses, enabling researchers to elucidate its biological mechanisms and interactions within the biofilm matrix. By improving our understanding of pscF's functions, scientists aim to develop novel interventions that disrupt biofilm integrity, thereby enhancing the effectiveness of existing antibiotics and reducing chronic infection rates. This avenue of research holds significant promise for addressing the challenges posed by antibiotic resistance in clinical settings, making pscF a focal point for ongoing studies in microbial pathogenesis and potential therapeutic applications.
