Analytical Data
-
Gene name
Mcpt4
- Application
-
Alternative Names
Mcpt4；Mast cell protease 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21812
-
Expression Region
21-246aa
-
AA Sequence
IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
-
Molecular Weight
29.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on Mcpt4 recombinant protein focuses on its role within the immune system, specifically in the context of mast cell function and allergic reactions. Mcpt4, also known as mouse mast cell protease 4, is a serine protease primarily expressed in mast cells and plays a crucial role in inflammatory responses. Its unique positioning in the immune pathway makes it a candidate for understanding the mechanisms underlying various allergic conditions and mast cell-related diseases. Studies have shown that Mcpt4 is involved in the regulation of cytokine production, influencing both innate and adaptive immune responses. The recombinant form of this protein allows researchers to investigate its biochemical properties, enzymatic activities, and potential interactions with other immune components, providing insights into its functional significance. By exploring the therapeutic potential of Mcpt4, researchers aim to develop targeted strategies for managing allergic disorders and enhancing our understanding of mast cell biology. This research is significant as it could lead to novel interventions for allergic diseases, which affect a substantial portion of the population worldwide.
