Analytical Data
-
Gene name
C20orf65
- Application
-
Alternative Names
GTSF1L; C20orf65; FAM112A; Gametocyte-specific factor 1-like; Protein FAM112A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1H1
-
Expression Region
1-148aa
-
AA Sequence
MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ
-
Molecular Weight
43.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf65, also known as "chromosome 20 open reading frame 65," is a gene that has garnered attention due to its potential role in various biological processes and its association with certain diseases. Research indicates that C20orf65 may be involved in cellular functions related to the immune response and inflammation, making it a candidate for further investigation in the context of autoimmunity and other inflammatory conditions. Recent studies suggest that the protein encoded by C20orf65 could interact with key signaling pathways, influencing protein synthesis and cellular proliferation. However, comprehensive studies on the protein's structure, function, and regulatory mechanisms remain limited, necessitating the development of recombinant protein for in-depth analysis. The generation of recombinant C20orf65 protein aims to facilitate the exploration of its biochemical properties, interactions, and functional role in health and disease. Understanding this protein's mechanisms could contribute to identifying new therapeutic targets for diseases linked to immune dysfunction and enhance our overall understanding of its biological significance. This investigation underscores the importance of C20orf65 in the broader context of genetic research, cellular biology, and potential clinical applications.
