Analytical Data
-
Gene name
C20orf70
- Application
-
Alternative Names
BPIFA2; C20orf70; SPLUNC2; UNQ510/PRO1025; BPI fold-containing family A member 2; Parotid secretory Protein; PSP; Short palate. lung and nasal epithelium carcinoma-associated Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DR5
-
Expression Region
1-249aa
-
AA Sequence
MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
-
Molecular Weight
53.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf70, also known as "Chromosome 20 Open Reading Frame 70," is a gene located on chromosome 20 that has garnered attention due to its potential roles in various biological functions and diseases. Recent studies have implicated C20orf70 in cellular processes such as apoptosis, immune response, and cell proliferation, making it a candidate for investigating mechanisms underlying disorders like cancer and autoimmunity. However, the biological functions and mechanisms of action of C20orf70 remain largely uncharacterized due to the lack of functional data and reliable assays for its protein product. To fill this gap, researchers have focused on the production and analysis of recombinant C20orf70 protein, which facilitates the exploration of its structural properties and biochemical activities. By generating this recombinant protein through techniques such as plasmid-based expression systems, scientists aim to elucidate how C20orf70 interacts with other cellular components and contributes to physiological and pathological processes. Understanding the role of C20orf70 at the molecular level could not only enhance our comprehension of its functional significance but also provide insights into its potential as a therapeutic target in various diseases. Thus, the generation and study of C20orf70 recombinant protein represent a critical step in advancing our knowledge in this area of research.
