Analytical Data
-
Gene name
C20orf71
- Application
-
Alternative Names
BPIFA3; C20orf71; SPLUNC3BPI fold-containing family A member 3; Short palate; lung and nasal epithelium carcinoma-associated Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQP9
-
Expression Region
1-218aa
-
AA Sequence
MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGRKHQQQQESRSFDNNIVKMCAHMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPS
-
Molecular Weight
50.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf71, located on chromosome 20, has garnered attention due to its potential role in various biological processes and disease mechanisms. Initially identified through genomic studies, this gene's protein product is believed to be involved in cellular functions such as RNA processing and regulation, making it a subject of interest in molecular biology and genetics. Recent studies have linked mutations in C20orf71 to several inherited disorders, particularly neurodegenerative conditions, which has prompted researchers to explore the functional implications of its protein. The recombinant protein of C20orf71 allows scientists to investigate its structural and functional properties in vitro, enabling a better understanding of how alterations in this protein may contribute to disease pathogenesis. Studies utilizing the recombinant form can elucidate the protein's interactions with other cellular molecules, its role in signaling pathways, and its effects on cell viability and proliferation. Furthermore, understanding the biophysical characteristics of C20orf71 through recombinant protein studies may reveal insights into its function and therapeutic potential. As ongoing research continues to unravel the complexities surrounding C20orf71, the recombinant protein serves as a crucial tool for advancing our knowledge in both fundamental biology and clinical implications.
