Analytical Data
-
Gene name
C22orf33
- Application
-
Alternative Names
TEX33; C22orf33; EAN57; Testis-expressed Protein 33
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43247
-
Expression Region
1-195aa
-
AA Sequence
MDPQSRSLKNAGSRSSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY
-
Molecular Weight
48.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C22orf33, also known as "Chromosome 22 Open Reading Frame 33," is a gene that has garnered significant interest due to its potential role in various biological processes, including development and disease mechanisms. Located on chromosome 22, the protein encoded by C22orf33 is still not fully characterized, but studies suggest that it may be involved in critical cellular functions. Research has indicated a potential link between C22orf33 and certain neurodevelopmental disorders, emphasizing the necessity for further investigation into its biochemical properties and functional implications. Recent advances in proteomics and molecular biology techniques have paved the way for the production of recombinant C22orf33 protein, allowing researchers to study its structure, interactions, and biological activities in a controlled setting. Understanding the functional role of C22orf33 could lead to insights into its involvement in pathophysiological conditions and may open up new avenues for therapeutic strategies targeting relevant pathways. Thus, the research on C22orf33 recombinant protein is crucial for elucidating its biological significance and potential medical applications.











