Cat: PA2000-6228

Recombinant Human C2orf53 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C2orf53

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRR30; C2orf53; Proline-rich Protein 30

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q53SZ7

  • Expression Region

    1-412aa

  • AA Sequence

    MLPQNKDQVLPQTSVLPGRPTWGFSQLVDSSPHNLQPLSPHQGLPPSQPPFSSTQSRRPSSPPPASPSPGFQFGSCDSNSDFAPHPYSPSLPSSPTFFHQNYLSLPRPRASSPSNHWLYPSPPLTPSFSPSQPQNSSLPHSPCQSPSHPEELHSSTLTSPGPSPPSHRLHSNRQTWRWHQYRDTGSGSPGVVEGCVPSEKDPAQFRDPGALAQALVVQLGHRRIAHDLRLLLLQHLWLGRTGQAPVVEYPICLVCLRPRSPSCPLPRYRTGPRLLAFPQLLPCVQGQESGPLRIGIGFGLRLPQGQARALHLLPEKRPKEAGPQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPRCFSGPPPRAPKQVTTSLKPRPCPGPKRPVSLELILQKSSV

  • Molecular Weight

    71 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C2orf53, also known as chromosome 2 open reading frame 53, is a protein-coding gene that has garnered interest in recent years due to its potential implications in various biological processes and disease states. The research surrounding C2orf53 focuses primarily on its structure and function, particularly in the context of cellular signaling and metabolic pathways. Emerging studies suggest that C2orf53 may play a significant role in cellular stress responses and possibly in the regulation of apoptosis, making it a candidate for further investigation in cancer research. Additionally, its expression patterns have been linked to certain neurological diseases, prompting inquiries into its role in neurodevelopment and neurodegeneration. The recombinant protein form of C2orf53 has been produced for functional assays, which aids in understanding its biochemical properties and interactions with other cellular components. Insights from these studies could provide a deeper understanding of the gene's involvement in health and disease, ultimately paving the way for novel therapeutic approaches targeting C2orf53-related pathways. As such, detailed analysis and characterization of C2orf53 recombinant protein are critical for elucidating its biological roles and regulatory mechanisms, contributing to a broader understanding of its significance in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US