Analytical Data
-
Gene name
C6orf136
- Application
-
Alternative Names
C6orf136Uncharacterized Protein C6orf136
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5SQH8
-
Expression Region
1-172aa
-
AA Sequence
MEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf136, also known as Chromosome 6 Open Reading Frame 136, is a gene located on chromosome 6, which has garnered interest in recent years due to its potential role in various biological processes and diseases. Initial studies suggested that C6orf136 might be involved in cellular functions such as cytokine signaling and immune responses. The protein encoded by this gene is of particular interest because it exhibits structural characteristics that are indicative of involvement in critical cellular pathways. Its expression patterns have been linked to several conditions, including autoimmune diseases and certain cancers, which raises questions about its function and mechanism of action. Furthermore, the exploration of C6orf136 recombinant protein has provided valuable insights into its biochemical properties, enabling researchers to study its interactions with other proteins and its functional implications in cellular contexts. Understanding the role of C6orf136 could uncover novel therapeutic targets and strategies for disease intervention, underscoring the importance of this protein in both basic research and clinical applications. As a result, ongoing investigations into the recombinant form of C6orf136 aim to elucidate its roles, enhance our understanding of related pathological mechanisms, and ultimately contribute to the development of targeted therapies.
