Analytical Data
-
Gene name
BBOX1
- Application
-
Alternative Names
BBOX1；BBH；BBOX；；Gamma-butyrobetaine dioxygenase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75936
-
Expression Region
1-387aa
-
AA Sequence
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN
-
Molecular Weight
71.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BBOX1, or BBox domain-containing protein 1, is a member of the BBox family of proteins, which are known to play significant roles in various biological processes, including cell proliferation, metabolism, and stress responses. Recent studies have highlighted the potential relevance of BBOX1 in cancer biology, given its involvement in regulating cellular signaling pathways and gene expression. This protein is of particular interest due to its unique structural features and its potential interactions with other key biomolecules. Understanding the functional mechanisms of BBOX1 is essential for elucidating its role in disease states, including malignancies where its expression levels may be altered. The recombinant expression and characterization of BBOX1 are crucial for investigating its biochemical properties, interactions, and potential therapeutic applications. Researchers are employing advanced techniques in molecular biology, biochemistry, and structural biology to study BBOX1, aiming to uncover its precise functions and regulatory mechanisms, as well as its impact on cellular health and disease progression. The insights gained from BBOX1 research could pave the way for novel therapeutic strategies targeting its pathways, thus contributing to the development of innovative treatments for cancer and other diseases associated with dysregulated protein expression. Overall, the study of BBOX1 represents a significant frontier in molecular biology, with implications for both basic research and clinical applications.
