Analytical Data
-
Gene name
RIC3
- Application
-
Alternative Names
AYST720; FLJ11608; PRO1385; Protein RIC-3; Resistance to inhibitors of cholinesterase 3 homolog; Resistant to inhibitor of cholinesterase 3; RIC3 acetylcholine receptor chaperone; Ric3; RIC3_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z5B4
-
Expression Region
1-368 aa
-
AA Sequence
MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
-
Molecular Weight
67.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RIC3 (Resistance to Inhibition of Cholinergic Receptor 3) is a protein that plays a crucial role in the functioning and regulation of nicotinic acetylcholine receptors (nAChRs), which are pivotal for neurotransmission in the central and peripheral nervous systems. The proper assembly and trafficking of nAChRs are vital for their physiological functions, and RIC3 has been identified as a chaperone that assists in their correct folding and maturation. Studies have shown that RIC3 can enhance the expression of certain nAChR subtypes, which has significant implications for understanding diseases such as Alzheimer's, Parkinson's, and other neurodegenerative disorders linked to cholinergic dysfunction. Furthermore, research into RIC3 has potential therapeutic implications, as modulating its activity could influence neuronal signaling pathways and offer new strategies for pharmacological intervention. Given the growing interest in the biological roles of nAChRs and their association with various pathologies, RIC3 serves as a critical target for further study, illuminating the complex mechanisms underlying receptor assembly and signaling in the nervous system. Understanding the precise molecular interactions and regulatory pathways involving RIC3 could pave the way for novel therapeutic approaches aimed at restoring cholinergic function in neurodegenerative diseases.
