Cat: PA1000-5890

Recombinant Human FACA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FACA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FACA;FAA;FACA;FANCH;Fanconi anemia group A Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15360

  • Expression Region

    1-297aa

  • AA Sequence

    MSDSWVPRSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRL LRSHQDLNALLLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQD QASRLGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVEQRKKLSSLLE FARYLLAHSMFSRLSFCQELWKIQSSLLLEAVWHLHVQGIVSLQELLESH PDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQMFVLRGFQKN SDLRRTVEPEKMPQVAVDVLQRMLIFALDALAAGVQEESSTHKIVRC

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FACA (Follistatin-related protein) is a crucial protein involved in various biological processes, including muscle development, cell signaling, and tissue repair. Research on FACA recombinant proteins has gained significant traction due to their potential therapeutic applications in regenerative medicine and disease treatment. Understanding the structure and function of FACA is essential for elucidating its role in modulating biological pathways, particularly in muscle atrophy and fibrosis-related conditions. The development of recombinant FACA proteins allows for detailed studies on its mechanisms of action and interactions with other signaling molecules, which can pave the way for novel therapeutic strategies. Furthermore, exploring the potential of FACA in muscle regeneration and repair can provide insights into combating age-related muscle loss and other degenerative diseases. The ongoing advancements in recombinant protein technology have made it possible to produce high yields of functional FACA, facilitating extensive biomedical research and applications in drug development and gene therapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US