Analytical Data
-
Gene name
CPLX2
- Application
-
Alternative Names
CPLX2；Complexin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PUV4
-
Expression Region
1-134aa
-
AA Sequence
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
-
Molecular Weight
42.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPLX2, or Complexin 2, is a protein predominantly expressed in the nervous system and plays a crucial role in synaptic transmission and neurotransmitter release. It is a member of the complexin family, which is involved in the regulation of SNARE (Soluble N-ethylmaleimide-sensitive factor attachment protein receptor) complex formation and stability, essential for vesicle fusion processes at synapses. Research on CPLX2 is gaining momentum due to its implications in understanding various neurological disorders, including synaptic dysfunctions linked to autism spectrum disorders, schizophrenia, and neurodegenerative diseases. The investigation of CPLX2 recombinant proteins has become increasingly significant, as such proteins are vital for elucidating the molecular mechanisms underlying synaptic regulation. By producing and studying CPLX2 in a recombinant system, researchers aim to explore its structural features, binding interactions with other synaptic proteins, and functional roles in neurotransmitter release. This research not only enhances our understanding of synaptic physiology but also opens avenues for developing therapeutic strategies targeting CPLX2-related pathologies. Overall, the study of CPLX2 recombinant proteins serves as a bridge between basic neuroscience and potential clinical applications, highlighting the importance of this protein in maintaining synaptic health and function.
