Cat: PA2000-6506

Recombinant Human CCDC53 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCDC53

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WASHC3; AD-016; CCDC53; CGI-116; x0009; WASH complex subunit 3; Coiled-coil domain-containing Protein 53

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3C0

  • Expression Region

    1-194aa

  • AA Sequence

    MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD

  • Molecular Weight

    47.6 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCDC53 (Coiled-Coil Domain Containing 53) is a protein that has gained attention in recent years due to its potential functions in cellular processes and disease mechanisms. Research has indicated that CCDC53 plays a crucial role in cilia formation and maintenance, which are essential for various cellular signaling pathways and developmental processes. Disruptions in cilia function are linked to a range of disorders known as ciliopathies, including Bardet-Biedl syndrome and Joubert syndrome. The importance of CCDC53 in these pathways has spurred interest in studying its structure and function. Recombinant CCDC53 protein can be expressed and purified for detailed biochemical studies, allowing researchers to explore its protein interactions, post-translational modifications, and functional assays. Understanding the molecular mechanisms involving CCDC53 may provide insights into its role in ciliary biology and the pathogenesis of related diseases, ultimately leading to innovative therapeutic strategies. Additionally, the recombinant protein serves as a valuable tool for screening small molecule inhibitors or enhancers that could modulate its function in cellular contexts, contributing to the broader field of drug discovery and development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US