Analytical Data
-
Gene name
KYAT1
- Application
-
Alternative Names
KYAT1；CCBL1；Kynurenine--oxoglutarate transaminase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16773
-
Expression Region
1-372aa
-
AA Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
-
Molecular Weight
58.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KYAT1, or Kynurenine Aminotransferase 1, is an important enzyme involved in the metabolism of tryptophan, a critical amino acid that impacts various physiological processes, including mood regulation, neuroprotection, and immune response. Research into KYAT1 has gained significant attention due to its role in the kynurenine pathway, which produces metabolites that can influence neuroinflammatory conditions and neurodegenerative diseases. Recent studies have associated dysregulation of KYAT1 activity with disorders such as depression, schizophrenia, and Alzheimer's disease, suggesting its potential as a therapeutic target. The recombinant expression of KYAT1 protein allows for detailed structural and functional studies, facilitating the understanding of its enzymatic properties and interactions with other metabolites. Such research may contribute to the development of novel treatments for psychiatric and neurological disorders by manipulating the kynurenine pathway. Understanding KYAT1's role at the molecular level can also illuminate its involvement in broader metabolic networks and help identify biomarkers for disease diagnosis and progression. Overall, the study of KYAT1 recombinant protein represents a promising avenue for advancing our knowledge of tryptophan metabolism and its implications for mental health and neurodegenerative diseases.
