Cat: PA1000-6865

Recombinant Human CHI3L2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHI3L2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CHI3L2;Chitinase-3-like Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15782

  • Expression Region

    27-390aa

  • AA Sequence

    YKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDK SEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFIN SIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKE RLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGH NSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLA SAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPY AVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQGP YPLVQAVKRSLGSLVDHHHHHH

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHI3L2, also known as chitinase 3-like 2, is a member of the chitinase family, which plays roles in inflammation, tissue remodeling, and immune responses. Its expression is often elevated in various inflammatory diseases, including asthma, rheumatoid arthritis, and certain cancers, indicating its potential as a biomarker for these conditions. Research has shown that CHI3L2 can influence cell signaling pathways, particularly those related to the innate immune response and tissue repair mechanisms. Given its association with pathological processes, CHI3L2 has gained attention as a therapeutic target and a tool for understanding the underlying mechanisms of disease. Recombinant forms of CHI3L2 enable detailed studies of its functional properties and interactions, paving the way for potential clinical applications in diagnosing and treating inflammatory and degenerative diseases. Further investigation into CHI3L2 may reveal its precise roles and mechanisms, contributing to the development of innovative strategies to modulate its activity and mitigate its effects in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US