Analytical Data
-
Gene name
COX8C
- Application
-
Alternative Names
COX8CCytochrome c oxidase subunit 8C; mitochondrial; Cytochrome c oxidase polypeptide 8 isoform 3; Cytochrome c oxidase polypeptide VIII isoform 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z4L0
-
Expression Region
1-72aa
-
AA Sequence
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN
-
Molecular Weight
34.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX8C, or cytochrome c oxidase subunit 8C, is an essential component of the mitochondrial respiratory chain, playing a pivotal role in cellular energy production through aerobic respiration. It is part of the enzyme complex IV, which catalyzes the reduction of oxygen to water, a process crucial for ATP synthesis. Research into COX8C has gained momentum due to its potential implications in various biomedical fields, including cancer biology, neurodegenerative diseases, and metabolic disorders. Deficiencies or mutations in COX8C can lead to impaired mitochondrial function, contributing to energy deficits in cells and affecting overall cellular homeostasis. Additionally, alterations in COX8C expression levels have been linked to the progression of certain tumors, highlighting its role in cancer metabolism. Recent advancements in recombinant protein technology have enabled scientists to produce COX8C in vitro, facilitating detailed studies of its structure, function, and interactions with other mitochondrial components. Understanding COX8C at a molecular level could provide insights into therapeutic strategies aimed at addressing mitochondrial dysfunction and associated diseases. Overall, the research on COX8C recombinant protein serves as a crucial stepping stone in elucidating the complex mechanisms of mitochondrial bioenergetics and their relevance to human health and disease.
