Analytical Data
-
Gene name
BLID
- Application
-
Alternative Names
BLID；BRCC2；BH3-like motif-containing cell death inducer
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZY5
-
Expression Region
1-108aa
-
AA Sequence
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
-
Molecular Weight
39.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BLID (Bcl2-Like Protein 1-Interacting Domain) is an intriguing protein that has garnered attention in the field of molecular biology due to its potential roles in cell survival and apoptosis regulation. Studies suggest that BLID serves as a crucial mediator in various signal transduction pathways, particularly those involving apoptosis and cell proliferation, making it a significant focus for understanding tumorigenesis and other pathological conditions. Its interactions with Bcl-2 family proteins indicate that it may influence mitochondrial apoptotic pathways, thus positioning BLID as a potential target for therapeutic intervention in cancer treatments. Furthermore, BLID's involvement in neural development and its expression in the central nervous system highlight its relevance in neurodegenerative diseases. Given the complexity and variability of protein interactions, researchers are investigating BLID through recombinant protein expression techniques to elucidate its structure-function relationships and to unravel its precise biological roles. By producing BLID as a recombinant protein, scientists can study its biochemical properties, identify its binding partners, and assess its functionality in cellular assays. This research not only aims to deepen the understanding of BLID's contributions to cellular homeostasis and disease mechanisms but also to explore its therapeutic potential in manipulating apoptotic pathways for clinical benefits. Overall, the investigation of BLID as a recombinant protein stands at the intersection of cancer research and neurobiology, promising valuable insights into fundamental biological processes that could lead to novel therapeutic approaches.
