Cat: PAX2000-11391

Recombinant Human SLC25A28 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC25A28

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC25A28; MFRN2; NPD016; Mitoferrin-2; Mitochondrial RNA-splicing protein 3/4 homolog; MRS3/4; hMRS3/4; Mitochondrial iron transporter 2; Solute carrier family 25 member 28

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96A46

  • Expression Region

    1-177 aa

  • AA Sequence

    MNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK

  • Molecular Weight

    46.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC25A28, a member of the mitochondrial solute carrier family, plays a crucial role in cellular metabolism by facilitating the transport of key substrates across the mitochondrial inner membrane. Research has increasingly focused on this protein due to its involvement in critical biochemical pathways, particularly in the transport of key metabolites such as glutamate and aspartate, which are vital for cellular energy production and amino acid synthesis. Mutations or dysfunction in SLC25A28 have been implicated in various metabolic disorders, including mitochondrial diseases that can lead to severe neurological and muscular symptoms. The study of SLC25A28 recombinant protein not only aims to elucidate its structure and transport mechanisms but also to explore its potential as a therapeutic target for alleviating mitochondrial dysfunction. Recombinant protein studies enable researchers to examine the protein's functional properties and interactions under controlled experimental conditions, thereby providing insights into its physiological roles and the consequences of its dysregulation. Understanding SLC25A28 at the molecular level may pave the way for novel interventions in treating mitochondrial-related disorders and contribute to the broader knowledge of mitochondrial biology and metabolism.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US