Analytical Data
-
Gene name
SLC25A28
- Application
-
Alternative Names
SLC25A28; MFRN2; NPD016; Mitoferrin-2; Mitochondrial RNA-splicing protein 3/4 homolog; MRS3/4; hMRS3/4; Mitochondrial iron transporter 2; Solute carrier family 25 member 28
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96A46
-
Expression Region
1-177 aa
-
AA Sequence
MNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK
-
Molecular Weight
46.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A28, a member of the mitochondrial solute carrier family, plays a crucial role in cellular metabolism by facilitating the transport of key substrates across the mitochondrial inner membrane. Research has increasingly focused on this protein due to its involvement in critical biochemical pathways, particularly in the transport of key metabolites such as glutamate and aspartate, which are vital for cellular energy production and amino acid synthesis. Mutations or dysfunction in SLC25A28 have been implicated in various metabolic disorders, including mitochondrial diseases that can lead to severe neurological and muscular symptoms. The study of SLC25A28 recombinant protein not only aims to elucidate its structure and transport mechanisms but also to explore its potential as a therapeutic target for alleviating mitochondrial dysfunction. Recombinant protein studies enable researchers to examine the protein's functional properties and interactions under controlled experimental conditions, thereby providing insights into its physiological roles and the consequences of its dysregulation. Understanding SLC25A28 at the molecular level may pave the way for novel interventions in treating mitochondrial-related disorders and contribute to the broader knowledge of mitochondrial biology and metabolism.
