Cat: PA2000-3239

Recombinant Human ACBD4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACBD4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACBD4;Acyl-CoA-binding domain-containing Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NC06

  • Expression Region

    1-305aa

  • AA Sequence

    MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR

  • Molecular Weight

    50.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACBD4 (Acyl-CoA Binding Domain Containing 4) is a protein that plays a crucial role in lipid metabolism and cellular signaling. Recent studies have highlighted its involvement in various cellular processes, including lipid droplet formation, membrane dynamics, and the regulation of cellular stress responses. ACBD4 is known to interact with acyl-CoA molecules, which are vital for fatty acid metabolism and energy homeostasis, implicating its potential role in metabolic disorders such as obesity and diabetes. Furthermore, research has suggested that ACBD4 may influence the trafficking of specific proteins and lipids within cells, which is essential for maintaining cellular homeostasis and responding to metabolic changes. Given the increasing prevalence of metabolic diseases and the critical role of lipid metabolism in overall health, understanding the function and regulatory mechanisms of ACBD4 is paramount. Studies exploring the expression patterns of ACBD4 in various tissues and under different physiological conditions could provide insights into its functional significance. Moreover, investigating the potential of ACBD4 as a biomarker or therapeutic target for metabolic diseases is an area of growing interest. In this context, the characterization of ACBD4 through recombinant protein studies could reveal essential insights into its structure-function relationships, paving the way for future applications in medicinal biochemistry and metabolic research. The ongoing exploration of ACBD4's biological roles promises to unveil novel mechanisms underlying lipid metabolism and cellular stress responses, which may ultimately contribute to the development of targeted therapies for metabolic disorders and significantly enhance our understanding of lipid biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US