Analytical Data
-
Gene name
SLC25A40
- Application
-
Alternative Names
SLC25A40; MCFP; Solute carrier family 25 member 40; Mitochondrial carrier family protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBP6
-
Expression Region
1-338 aa
-
AA Sequence
MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENETCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLRDVPFSAMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTYESHKISMPLHMSTWIIMKNIVAKNGFSGLFSGLIPRLIKIAPACAIMISTYEFGKAFFQKQNVRRQQY
-
Molecular Weight
64.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A40, a member of the SLC (solute carrier) family, is an important mitochondrial protein primarily known for its role in the transport of metabolites across mitochondrial membranes. Research into SLC25A40 has gained attention due to its potential implications in energy metabolism and disease states such as metabolic disorders and neurodegenerative conditions. Previous studies have suggested that SLC25A40 might be involved in regulating mitochondrial function, influencing processes such as ATP production, reactive oxygen species (ROS) generation, and the overall bioenergetic profile of cells. Moreover, the understanding of SLC25A40 can provide insights into how alterations in its function could contribute to pathological conditions. Despite its significance, comprehensive studies on SLC25A40 are still limited, and the detailed mechanisms of its transport activity remain poorly characterized. Recombinant protein expression of SLC25A40 is essential for functional assays to elucidate its substrate specificity and transport kinetics. Establishing effective protein purification and characterization protocols will enhance our understanding of SLC25A40's role in mitochondrial physiology and its potential as a therapeutic target. As mitochondrial dysfunction is a key factor in numerous diseases, understanding the functional dynamics of SLC25A40 could pave the way for novel interventions aimed at restoring mitochondrial health and benefiting patients suffering from related disorders. Thus, ongoing research into the recombinant expression and functional analysis of SLC25A40 is critical for elucidating its biological significance and therapeutic potential.
