Analytical Data
-
Gene name
ZFP36
- Application
-
Alternative Names
ZNF823; ZFP36; Zinc finger Protein 823; Zinc finger Protein ZFP-36
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16415
-
Expression Region
1-326 aa
-
AA Sequence
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
-
Molecular Weight
60.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP36, also known as tristetraprolin (TTP), is a member of the CCCH-type zinc finger protein family, which plays a crucial role in regulating mRNA stability and decay. Research has shown that ZFP36 exhibits anti-inflammatory properties by binding to the AU-rich elements in the 3' untranslated regions of various pro-inflammatory cytokine mRNAs, thereby promoting their degradation. This regulation is particularly important in conditions such as chronic inflammation and autoimmune diseases, where excessive cytokine production can lead to tissue damage. Recombinant ZFP36 protein studies aim to elucidate its functional mechanisms and therapeutic potential. By producing ZFP36 in recombinant systems, researchers can investigate its effects on cytokine regulation and its potential use in treatment modalities for inflammatory diseases. Through these studies, ZFP36 is gaining attention not only for its role in fundamental biological processes but also for its promise in clinical applications where modulation of the immune response is necessary. Understanding the structure-function relationship of ZFP36 at a molecular level may pave the way for the development of novel anti-inflammatory therapies that leverage its mRNA-binding capabilities, potentially improving outcomes in patients with inflammatory conditions.
