Analytical Data
-
Gene name
UCP4
- Application
-
Alternative Names
UCP4；UCP4；Mitochondrial uncoupling Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95847
-
Expression Region
1-323aa
-
AA Sequence
MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCP4, or uncoupling protein 4, is a member of the uncoupling protein family, which plays a crucial role in regulating mitochondrial function and energy metabolism in mammals. It is primarily expressed in the brain and particularly abundant in the brain regions associated with motor and cognitive functions. Research on UCP4 has gained momentum due to its potential implications in neuroprotection and neurodegenerative diseases, as it is believed to mitigate oxidative stress and improve mitochondrial efficiency. Studies have also suggested that UCP4 may be involved in thermogenesis and energy expenditure, influencing metabolic disorders such as obesity and diabetes. Furthermore, the exploration of UCP4 recombinant proteins has provided insights into its structure-function relationship and facilitated the understanding of its biological mechanisms. The significance of UCP4 in maintaining neural health and its potential therapeutic applications continue to make it a focus of scientific research, as elucidating its pathways could pave the way for novel interventions in neurodegenerative diseases and metabolic syndromes.
