Cat: IPD-X35924

Recombinant Human Siglec-2/CD22 Protein (HEK293),Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Siglec-2/CD22

  • 简介

    The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues. It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface. Siglec-2/CD22 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Siglec-2/CD22 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B-cell receptor CD22; BL-CAM; B-lymphocyte cell adhesion molecule; CD22 antigenMGC130020; CD22; T-cell surface antigen Leu-14

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20273

  • Expression Region

    D20-R687

  • AA Sequence

    DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    110-130 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Siglec-2, also known as CD22, is a member of the Sialic Acid Binding Immunoglobulin-like Lectins (Siglecs) family, which plays a crucial role in regulating B-cell activation and function. CD22 is predominantly expressed on B cells and serves primarily as an inhibitory receptor that modulates immune responses. Research has shown that Siglec-2/CD22 binding to sialic acid-containing glycoproteins can negatively regulate B cell receptor (BCR) signaling, thereby preventing excessive activation and autoimmunity. The therapeutic potential of targeting CD22 has gained interest, particularly in the context of B-cell malignancies such as acute lymphoblastic leukemia (ALL) and B-cell lymphoma. The development of CD22-targeted immunotherapies, including antibody-drug conjugates and CAR T-cell therapies, demonstrates promising efficacy in clinical settings. Consequently, the generation of recombinant CD22 protein is essential for further elucidating its structural and functional properties, as well as for the development of novel therapeutic strategies. Understanding the interactions between CD22 and its ligands at the molecular level can provide insights into the mechanisms of B cell regulation and pave the way for innovative treatments for B-cell disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US