Cat: IPD-X35512

Recombinant Human PPAR alpha Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPAR alpha

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPARA, PPAR-α

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q07869-1

  • Expression Region

    D202-Y468

  • AA Sequence

    DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

  • Protein Length

    Partial

  • Molecular Weight

    32.5kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPAR alpha (Peroxisome Proliferator-Activated Receptor Alpha) is a nuclear receptor that plays a critical role in lipid metabolism, glucose homeostasis, and inflammation regulation. It is part of the PPAR family, which includes PPAR gamma and PPAR beta/delta, each exhibiting distinct yet overlapping biological functions. PPAR alpha is predominantly expressed in tissues with high fatty acid oxidation rates, such as liver, muscle, and heart. Its activation by natural ligands, such as fatty acids and eicosanoids, as well as synthetic agonists, leads to the transcription of genes involved in fatty acid transport, beta-oxidation, and lipoprotein metabolism. Dysregulation of PPAR alpha is associated with metabolic disorders, cardiovascular diseases, and certain types of cancer. Research on recombinant PPAR alpha proteins has gained traction to better understand its structure-function relationships, facilitate high-throughput screening of potential ligands, and design novel therapeutics that can modulate its activity. Such studies employ techniques like protein expression in various systems, biochemical assays, and structural biology to elucidate the mechanisms underlying PPAR alpha-mediated pathways. The advancements in recombinant protein technology also pave the way for developing more precise therapeutic interventions targeting PPAR alpha, with the potential to improve metabolic health and treat related diseases effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US