Analytical Data
-
Gene name
PPAR alpha
- Application
-
Alternative Names
PPARA, PPAR-α
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07869-1
-
Expression Region
D202-Y468
-
AA Sequence
DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
-
Protein Length
Partial
-
Molecular Weight
32.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPAR alpha (Peroxisome Proliferator-Activated Receptor Alpha) is a nuclear receptor that plays a critical role in lipid metabolism, glucose homeostasis, and inflammation regulation. It is part of the PPAR family, which includes PPAR gamma and PPAR beta/delta, each exhibiting distinct yet overlapping biological functions. PPAR alpha is predominantly expressed in tissues with high fatty acid oxidation rates, such as liver, muscle, and heart. Its activation by natural ligands, such as fatty acids and eicosanoids, as well as synthetic agonists, leads to the transcription of genes involved in fatty acid transport, beta-oxidation, and lipoprotein metabolism. Dysregulation of PPAR alpha is associated with metabolic disorders, cardiovascular diseases, and certain types of cancer. Research on recombinant PPAR alpha proteins has gained traction to better understand its structure-function relationships, facilitate high-throughput screening of potential ligands, and design novel therapeutics that can modulate its activity. Such studies employ techniques like protein expression in various systems, biochemical assays, and structural biology to elucidate the mechanisms underlying PPAR alpha-mediated pathways. The advancements in recombinant protein technology also pave the way for developing more precise therapeutic interventions targeting PPAR alpha, with the potential to improve metabolic health and treat related diseases effectively.











