Analytical Data
-
Gene name
PPAR gamma
- Application
-
Biological Activity
1. PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay. 2. Measured by its binding ability in a functional ELISA. Immobilized GW9662 (HY-P16578) at 20 μg/mL (100 μ L/well) on the plate can bind Biotinylated Human PPAR gamma. The ED50 for this effect is 1.685 μg/mL. PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
-
Alternative Names
PPAR-γ-LBD
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P37231-1
-
Expression Region
D238-D503
-
AA Sequence
DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD
-
Protein Length
Partial
-
Molecular Weight
30-32.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Peroxisome proliferator-activated receptor gamma (PPAR-γ) is a nuclear receptor that plays a critical role in the regulation of fatty acid metabolism and glucose homeostasis. As a member of the PPAR family, PPAR-γ is highly expressed in adipose tissue and is pivotal for adipogenesis, the process through which pre-adipocytes differentiate into mature adipocytes. Its activation by endogenous ligands, such as fatty acids and eicosanoids, as well as pharmaceutical agents like thiazolidinediones, enhances insulin sensitivity and is implicated in the management of type 2 diabetes mellitus. Research has shown that PPAR-γ also influences other critical biological processes, including inflammation and cell proliferation, linking it to various pathologies beyond metabolic disorders, such as cancer and cardiovascular diseases. Given its significant role in metabolic regulation and pathological conditions, recombinant PPAR-γ protein has become an important tool for studying its functional mechanisms, ligand interactions, and the effects of specific mutations. By producing and characterizing recombinant PPAR-γ, researchers aim to elucidate its structure-function relationships and therapeutic potentials, paving the way for novel treatments that target PPAR-γ pathways. The understanding of PPAR-γ biology through recombinant protein studies may ultimately lead to innovative strategies for managing obesity-related conditions and improving metabolic health.











