Analytical Data
-
Gene name
CD200R1L
-
简介
The CD200R1L protein is a potential receptor for the CD200/OX2 cell surface glycoprotein and has been shown to play a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L may engage in complex interactions with CD200, contributing to immune regulation and cellular communication. CD200R1L Protein, Human (HEK293, His) is the recombinant human-derived CD200R1L protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED50 for this effect is 1.605 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED50 for this effect is 1.605 μg/mL.
-
Alternative Names
Cell surface glycoprotein CD200 receptor 2; HuCD200R2; CD200RLa; CD200R1L; CD200R2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6Q8B3-1
-
Expression Region
G24-L239
-
AA Sequence
GKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCHVSHLTGNKSLSVKLNSGLRTSGSPALSLL
-
Protein Length
Extracellular Domain
-
Molecular Weight
40-56 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD200R1L, a member of the CD200 receptor family, plays a critical role in modulating immune responses. This receptor is primarily expressed on myeloid cells, such as macrophages and dendritic cells, where it interacts with CD200 on neighboring cells to deliver inhibitory signals that help maintain immune homeostasis and prevent excessive inflammation. Research has shown that dysregulation of CD200-CD200R1L signaling is associated with several autoimmune diseases, chronic inflammatory conditions, and even cancer progression. The recombinant protein CD200R1L has gained interest for its potential therapeutic applications, particularly in conditions where modulation of the immune response is desirable. By expressing and purifying CD200R1L as a recombinant protein, researchers aim to better understand its biological functions, elucidate the mechanisms underlying its inhibitory effects on immune cells, and explore its use as a therapeutic agent or a biomarker. The study of CD200R1L may offer new insights into immune regulation and pave the way for innovative treatments targeting immune-mediated diseases.
