Analytical Data
-
Gene name
LAMP1/CD107a
-
简介
LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Lysosome-associated membrane glycoprotein 1; LAMP-1; LGP-A; CD107a; LAMPA; P2B
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11438
-
Expression Region
L25-N370
-
AA Sequence
LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN
-
Protein Length
Lumenal Domain
-
Molecular Weight
55-94 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMP1, also known as CD107a, is a significant lysosomal membrane protein that plays a crucial role in various cellular processes, including autophagy, immune response, and cellular signaling. Research on LAMP1/CD107a has gained momentum due to its implications in the functioning of immune cells, particularly in the context of cytotoxic T lymphocyte (CTL) activity. As a marker for degranulation in CTLs, the expression of LAMP1/CD107a on the cell surface provides insights into the effectiveness of immune responses against tumors and viral infections. Additionally, increased interest in understanding the molecular mechanisms regulating LAMP1/CD107a has led to its potential as a therapeutic target in immunotherapy strategies. By studying the recombinant protein form of LAMP1/CD107a, researchers aim to elucidate its structural and functional aspects, providing a deeper understanding of its involvement in immune modulation. This research could pave the way for novel interventions in cancer therapy and autoimmune diseases, highlighting the relevance of LAMP1/CD107a in enhancing our knowledge of immune system dynamics and developing targeted treatments.











