Cat: IPD-X21840

Recombinant Cynomolgus FCRN-B2M Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCRN-B2M

  • 简介

    The FCGRT protein delivers passive immunity by binding to monomeric IgG and promoting its absorption from milk. It forms an FcRn-IgG complex, which is transcytosis by the intestinal epithelium and releases IgG into the bloodstream or interstitial fluid. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293 , with C-His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, His), has molecular weight of ~35 & 12 kDa, respectively.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When FCRN-B2M is immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated Human lgG1. The ED50 for this effect is 68.15 ng/mL. Measured by its binding ability in a functional ELISA. When FCRN-B2M is immobilized at 2 µg/mL (100 µL/well),can bind Biotinylated Human lgG1,The ED50 for this effect is 68.15 ng/mL.

  • Alternative Names

    FCGRT-B2M Heterodimer Protein; IgG receptor FcRn large subunit p51; Beta-2-microglobulin

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8SPV9 (A24-S297)&Q8SPW0

  • Expression Region

    Q8SPV9 (A24-S297)&Q8SPW0 (I21-M119)

  • AA Sequence

    AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS&IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

  • Molecular Weight

    35&12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCRN-B2M is a recombinant protein that plays a significant role in the immune system and antigen presentation. The Fc receptor neonatal (FCRN) is crucial for the transport of IgG antibodies and the regulation of their half-life. It binds to the Fc region of IgG and plays a pivotal role in protecting IgG from degradation. Beta-2-microglobulin (B2M), an essential component of major histocompatibility complex (MHC) class I molecules, is pivotal for the stability and expression of these molecules on the cell surface. The investigation of FCRN-B2M fusion protein has gained traction in the context of developing novel therapeutic strategies, particularly in diseases associated with immune dysregulation and cancer. Research suggests that manipulating the interaction between FCRN and IgG may enhance the efficacy and duration of antibody-based therapies. Moreover, understanding the structure and function of FCRN-B2M can provide insights into improving immune response and tailoring treatments for autoimmune diseases and malignancies. Studies are focusing on the challenges associated with protein expression, purification, and optimal use of recombinant technology to maximize therapeutic potential. Overall, FCRN-B2M represents a compelling focus in immunology and biotechnology, combining insights from protein engineering, innate and adaptive immunity, and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US