Cat: IPD-X21871

Recombinant Mouse Fc epsilon RIA/FCER1A Protein(HEK293), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Fc epsilon RIA/FCER1A

  • 简介

    Fc epsilon RIA/FCER1A protein is a high-affinity receptor for immunoglobulin epsilon/IgE and is critical for mediating IgE effector function. It activates and differentiates myeloid cells after binding IgE and cross-linking with antigens/allergens, causing mast cells, basophils, and eosinophils to secrete mediators and cytokines. Fc epsilon RIA/FCER1A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fc epsilon RI alpha; FCE1A; FCER1A; FcERI; FceRIa

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20489

  • Expression Region

    A24-Q204

  • AA Sequence

    ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    64.07 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fc epsilon receptor I alpha (FcεRIα) is a crucial protein involved in IgE-mediated allergic responses and is primarily found on the surface of mast cells and basophils. The engagement of IgE with FcεRIα leads to cell activation and the release of histamines and other mediators contributing to allergic diseases such as asthma, allergic rhinitis, and anaphylaxis. Understanding the structure and function of FcεRIα is essential for developing novel therapeutic strategies to manage allergic conditions. Recombinant FcεRIα protein serves as a valuable tool for investigating the molecular mechanisms underlying IgE signaling and receptor activation. It also facilitates the study of FcεRIα interactions with various ligands and monoclonal antibodies, which may lead to the identification of potential therapeutic inhibitors or modulators of allergic responses. Moreover, the characterization of recombinant FcεRIα contributes to the design of specific immunoassays for diagnosing allergy-related disorders. Overall, research on FcεRIα and its recombinant forms is pivotal for advancing our knowledge of allergic reactions and improving clinical approaches to allergy management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US