Cat: IPD-X21920

Recombinant Human IgG1 Protein(HEK293), Avi

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IgG1

  • 简介

    The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human CD64 at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED50 for this effect is 25.141 ng/mL. Immobilized Human CD64 at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED50 for this effect is 25.141 ng/mL.

  • Alternative Names

    Ig gamma-1 chain C region; IGHG1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01857-1

  • Expression Region

    D104-K330, D239E, L241M

  • AA Sequence

    DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  • Protein Length

    Partial

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IgG1 recombinant proteins play a crucial role in various biomedical applications, particularly in immunology and therapeutic development. Immunoglobulin G (IgG) is the most abundant antibody type in serum, with IgG1 being the predominant subclass in humans, known for its ability to effectively neutralize pathogens and activate various immune responses. The recombinant production of IgG1 proteins enables researchers to generate well-defined, high-purity antibodies for diagnostic and therapeutic uses. Advances in recombinant DNA technology, particularly the use of mammalian cell systems for expression, have significantly improved the yield and functionality of IgG1 proteins. These engineered antibodies are essential for the development of targeted therapies, especially in the treatment of cancers, autoimmune diseases, and infectious diseases. Additionally, the engineering of IgG1 to improve its properties, such as stability and binding affinity, has become a focus of research, allowing for the creation of bispecific antibodies and antibody-drug conjugates that enhance therapeutic efficacy while minimizing side effects. Understanding the structure-function relationship of IgG1 recombinant proteins is vital for optimizing their use in clinical settings, making this area of research not only scientifically intriguing but also of significant therapeutic relevance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US