Analytical Data
-
Gene name
RANKL/TNFSF11
-
简介
RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human (HEK293, hFc) is a recombinant human RANKL (G63-D244) with N-terminal hFc tag, which is produced in HEK293[1][2].
- Application
-
Biological Activity
The bioactivity was determined by measuring the ability of RANKL to induce TRAP activity in RAW 264.7 cells. The ED50 for this effect is ≤10 ng/mL, corresponding to a specific activity is ≥1×105 U/mg The bioactivity was determined by measuring the ability of RANKL to induce TRAP activity in RAW264.7 cells. The ED50 for this effect is 8.028 ng/mL, corresponding to a specific activity is 1.246×105 U/mg.
-
Alternative Names
Tumor necrosis factor ligand superfamily member 11; RANKL; CD254; ODF; OPGL; TNFSF11; TRANCE
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A7N9DBU4
-
Expression Region
G136-D317
-
AA Sequence
GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATNIPTGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISVEVSNPSLLDPDQDATYFGAFKVRDID
-
Protein Length
Partial
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process











