Cat: IPD-X20014

Recombinant Human OX40/TNFRSF4 Protein(HEK293), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OX40/TNFRSF4

  • 简介

    OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Human (HEK293, Fc) is a recombinant human OX40 (L29-A216) with C-terminal Fc tag, which is produced in HEK293.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human OX40/TNFRSF4 is immobilized at 10 µg/mL(100 µL/well) can bind Recombinant Human OX40 Ligand. The ED50 for this effect is 2.903 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human OX40/TNFRSF4 is immobilized at 10 µg/mL(100 µL/well) can bind Recombinant Human OX40 Ligand. The ED50 for this effect is 2.903 ng/mL.

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; TNFRSF4; OX40; CD134; Txgp1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43489

  • Expression Region

    L29-A216

  • AA Sequence

    LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

  • Protein Length

    Partial

  • Molecular Weight

    70.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OX40, also known as TNFRSF4, is a member of the tumor necrosis factor receptor (TNFR) superfamily that plays a vital role in regulating immune responses, particularly in the activation and survival of T cells. Its interaction with the ligand OX40L enhances T cell proliferation, survival, and cytokine production, making it a critical co-stimulatory molecule in the immune system. Research has shown that OX40 signaling can improve anti-tumor immunity and has been implicated in various diseases, including autoimmune disorders and cancer. The development of OX40/TNFRSF4 recombinant proteins has become a focus of investigation, as these proteins can serve as therapeutic agents or tools for studying OX40 biology in detail. By understanding the mechanisms of OX40 engagement and its downstream signaling pathways, researchers aim to harness this knowledge for therapeutic interventions, including immunotherapies that could potentiate or restore T cell function in cancer and chronic infections. Exploring the structural and functional aspects of OX40/TNFRSF4 recombinant proteins will enhance our comprehension of their roles in immune regulation and could lead to novel strategies for enhancing anti-tumor immunity or modulating immune responses in autoimmune diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US