Cat: IPD-X22339

Recombinant Rhesus Macaque Siglec-3/CD33 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Siglec-3/CD33

  • 简介

    Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Myeloid Cell Surface Antigen CD33; Siglec-3; gp67; CD33; SIGLEC3

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A2K5W2R5

  • Expression Region

    M16-G248

  • AA Sequence

    MDPRVRLEVQESVTVQEGLCVLVPCTFFHPVPYHTRNSPVHGYWFREGAIVSLDSPVATNKLDQEVREETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMEKGSTKYSYKSTQLSVHVTDLTHRPQILIPGALDPDHSKNLTCSVPWACEQGTPPIFSWMSAAPTSLGLRTTHSSVLIITPRPQDHGTNLTCQVKFPGAGVTTERTIQLNVSYASQNPRTDIFLGDGSG

  • Protein Length

    Partial

  • Molecular Weight

    45.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Siglec-3, also known as CD33, is a sialic acid-binding immunoglobulin-like lectin predominantly expressed on the surface of myeloid cells, including monocytes and granulocytes. Its role in the immune system is significant, as it is involved in regulating cellular interactions and modulating immune responses. CD33 functions primarily as an inhibitory receptor, playing a crucial role in the negative regulation of immune activation. Elevated expression of CD33 has been associated with various hematological malignancies, particularly in acute myeloid leukemia (AML), where it serves as a potential therapeutic target. Research into recombinant CD33 proteins has gained momentum due to their potential utility in targeted therapies and drug delivery systems. By engineering CD33-based recombinant proteins, scientists aim to explore their ability to selectively bind to CD33-expressing cells, allowing for the development of novel immunotherapeutic approaches that can enhance the efficacy of existing treatments while minimizing side effects. Additionally, these studies aim to unravel the mechanistic insights behind CD33's role in immune modulation, and its involvement in tumor microenvironments. Overall, the investigation of Siglec-3/CD33 recombinant proteins holds promise in improving therapeutic strategies for cancer and other diseases linked to immune dysfunction, paving the way for innovative treatments that could lead to more effective patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US