Cat: IPD-X22463

Recombinant Mouse CD20/MS4A1 Protein(P. pastoris), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD20/MS4A1

  • 简介

    CD20/MS4A1 protein regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. It activates store-operated calcium channels, allowing calcium influx through B-cell receptor/BCR activation. CD20/MS4A1 protein forms homotetramers and interacts with cell surface IgM chains, the antigen-binding parts of the BCR. CD20/MS4A1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived CD20/MS4A1 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Mouse CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED50 for this effect is 1.066 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Mouse CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED50 for this effect is 1.066 μg/mL.

  • Alternative Names

    Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; CD antigen

  • Species

    Mouse

  • Source

    P. pastoris

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19437

  • Expression Region

    V111-P291

  • AA Sequence

    VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

  • Protein Length

    Partial

  • Molecular Weight

    33 kDa.The reducing (R) protein migrat es as 33 kDa in SDS-PAGE may be due to glycosylation.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD20, also known as MS4A1, is a transmembrane protein predominantly expressed on the surface of B cells, playing a crucial role in B cell development, activation, and differentiation. As a key target in the treatment of various hematological malignancies, such as non-Hodgkin lymphoma and chronic lymphocytic leukemia, CD20 serves as a potent biomarker for therapeutic interventions, including monoclonal antibody therapies like Rituximab. The recombinant protein form of CD20/MS4A1 has garnered significant attention in recent research, as it facilitates the understanding of the structure-function relationship of this protein and aids in the development of targeted therapies. Production of recombinant CD20/MS4A1 enables the exploration of its interactions with immune cells, the elucidation of its signaling pathways, and the assessment of its potential as an antigen for vaccine development. Moreover, the study of this recombinant protein assists in overcoming clinical challenges associated with CD20-targeted therapies, such as tumor resistance and heterogeneity. As a result, ongoing research aims to enhance therapeutic efficacy and identify novel approaches for B cell malignancies, ultimately improving patient outcomes in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US